PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00799.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 284aa    MW: 31375.8 Da    PI: 6.6734
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00799.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-153683148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g+WT+eEd +lv  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  Zmw_sc00799.1.g00030.1.sm.mk 36 KGPWTEEEDAQLVWFVRLFGERRWDFLAKVSGLKRTGKSCRLRWVNYL 83
                                  79********************************************97 PP

2Myb_DNA-binding49.41.1e-1589132146
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                   rgr T++E+ l++++++++G++ W++Iar ++ gRt++++k++w++
  Zmw_sc00799.1.g00030.1.sm.mk  89 RGRITADEERLILELHAKWGSR-WSRIARSLP-GRTDNEIKNFWRT 132
                                   899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.5683183IPR017930Myb domain
SuperFamilySSF466895.72E-2834130IPR009057Homeodomain-like
SMARTSM007171.9E-133585IPR001005SANT/Myb domain
PfamPF002491.1E-133683IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-203790IPR009057Homeodomain-like
CDDcd001671.15E-103883No hitNo description
PROSITE profilePS5129422.43384138IPR017930Myb domain
SMARTSM007171.0E-1388136IPR001005SANT/Myb domain
PfamPF002496.4E-1489132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2291136IPR009057Homeodomain-like
CDDcd001677.28E-1193132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MCSSNKNNSK KQQGGGEQQK SGGSSTTASM AAAMRKGPWT EEEDAQLVWF VRLFGERRWD  60
FLAKVSGLKR TGKSCRLRWV NYLHPGLRRG RITADEERLI LELHAKWGSR WSRIARSLPG  120
RTDNEIKNFW RTRTRKQKAL GERPQCKDDD KSTTMTASPS SSTVTSAFFS GGGAATSSST  180
VTESALQGSS GGDDEAELDE ASTTTAATAT QHQQPHQQEC YTMDQLLLWN EMAAASYSMD  240
SWGIGHAAAP AEPASMPSPL WELCADNSLW MIDDEEYYKT LDAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-25361374104MYB PROTO-ONCOGENE PROTEIN
1msf_C1e-25361374104C-Myb DNA-Binding Domain
1mse_C1e-25361374104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660308.12e-99PREDICTED: transcription factor MYB59-like
TrEMBLK3ZD382e-99K3ZD38_SETIT; Uncharacterized protein
STRINGSi024470m6e-99(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169